Sign In | Join Free | My lightneasy.org
lightneasy.org
Products
Search by Category
Home > Chemicals > Chemical Waste >

Cjc 1295 Ghrp 6 Dosage

cjc 1295 ghrp 6 dosage

All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

Total 4291 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
Buy cheap  product

Brand Name:Hong Kong Blue

Model Number:CJC 1295 DAC

Place of Origin:China

.../vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial CAS NO.: 863288-34-0 Synonyms: CJC-1295 DAC, CJC 1295...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Kafen

Model Number:863288-34-0

Place of Origin:China

...Injectable Anabolic Steroids human growth peptides Powder Cjc -1295 Dac Basic Info. other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine Grad Classification: Brassinosteroid CAS:...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Bodybiological

Model Number:CJC 1295 with Dac

Place of Origin:Hubei, China

...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Pharm

Model Number:hannah@chembj.com

Place of Origin:China

...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH). Their...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:steriodshow

Model Number:863288-34-0

Place of Origin:china manufactuer

...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:HKYC

Model Number:PEPTIDE POWDER

Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Biofriend

Model Number:87616-84-0

Place of Origin:China

...Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Prohormones Steroids Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:China, Hunan

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Buy cheap  product

Brand Name:LSW

Model Number:CAS:51753-57-2

Place of Origin:China

...Cjc-1295 Peptide Human Growth Steroid Cjc-1295 with Dac for Muscle Enhance with reasonable price and safe delivery Quick Detail: Products Name; CJC 1295 CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Huao(skype:mia9403)

Model Number:CJC-1295 with DAC

Place of Origin:China

...Growth Hormone Releasing Hormone GHRH CJC 1295 With DAC For Bodybuilder Contact Abby by trustful@ycgmp.com Skype:mia9403 Whatsapp:+8618826123740 Quick detail : CJC 1295 With DAC Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Anabolic-Oral Steroid

Model Number:CJC-1295

Place of Origin:China

...Injectable Peptide Steroid Human Growth CJC-1295 / CJC-1295 without DAC 2mg/vial with Colorful Tops CJC-1295 Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Biopro

Model Number:GHP-06

Place of Origin:China

..., if you visit your favorite peptide company’s internet site, you will notice that there is a CJC-1295 with, and another one without DAC. Logically, you will ask yourself – what are the differences...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Buy cheap  product

Brand Name:CJC-1295 DAC

Model Number:CAS Number 863288-34-0

Place of Origin:China

...Releasing Hormone GHRH Peptide CJC 1295 with DAC, Healthy Anti Aging Hormones CJC 1295 DAC with Safe Shipment Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Buy cheap  product

Brand Name:N/A

Model Number:CJC 1295

Place of Origin:China

...Protuct Name CJC 1295 Appearance white power Molecular Formula C152H252N44O42 Place of Origin China (Mainland) Function bodybuilding, anti-aging ...

Zhongweiye Biological Technology
Site Member

Hebei

Buy cheap  product

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request