Sign In | Join Free | My lightneasy.org
lightneasy.org
Products
Search by Category
Home > Chemicals > Adsorbents >

Cjc 1295 Ghrp 6 Dosage

cjc 1295 ghrp 6 dosage

All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

Total 5412 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
Buy cheap Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 product

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap 99% Purity Mass-Gains Injectable Peptides Cjc 1295 No Dac ( CJC-1295 without Dac ) product

Brand Name:Bodybuilding

Model Number:CJC-1295

Place of Origin:China

...99% Purity Mass-Gains Injectable Peptides Cjc 1295 No Dac (CJC-1295 without Dac) Basic Information for CJC-1295 without DAC Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap CJC-1295 Without DAC 863288-34-0 Releasing Hormones (GHRH) purity 98% product

Brand Name:CJC-1295 Without DAC

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their action in the ...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap Weight Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial 863288-34-0 product

Brand Name:Sendi

Model Number:CJC-1295 With DAC

Place of Origin:China

... Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 What is CJC-1295? 1. Cjc-1295 is also...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap CJC -1295 Without DAC Peptide Hormones Muscle Building CAS 863288-34-0 product

Brand Name:Pharm

Model Number:hannah@chembj.com

Place of Origin:whatsapp: +86 138 7101 4054

...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH). Their...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Hubei

Buy cheap 5mg/vial Protein Peptide Hormones 100% Safe DHL to USA CJC 1295 with Dac product

Brand Name:Bodybiological

Model Number:CJC 1295 with Dac

Place of Origin:Hubei, China

...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Buy cheap White Powder Steroid Injections Peptide CJC 1295 Dac 2 Mg / Vial For Elderly product

Brand Name:HKYC

Model Number:CJC1295 DAC

Place of Origin:HUBEI,CHINA

...Manufacture Direct Sale Steroid Injections Cjc-1295 Dac Pure Peptides 2 Mg/ Vial Basic Info: Port: Guangzhou, China Production Capacity:500-1000kg/Month ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap White crystalline powder Cjc-1295 with Dac (863288-34-0) Cjc1295 / Cjc-1295 Without Dac product

Brand Name:steriodshow

Model Number:863288-34-0

Place of Origin:china manufactuer

...Product Description 1.the prodcts information 1.1the basic informations CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap Powerful CJC 1295 With Dac Growth Hormone Peptide 2mg For Lean Muscles product

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap CJC 1295 Without DAC Growth Hormone Peptides White Lyophilized Peptide HGH CJC-1295 Dosage Benefits product

Brand Name:Yvonne

Model Number:863288-34-0

Place of Origin:China

...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Buy cheap Long - half Life Human Peptide 2mg/vial CJC-1295 Dac Injury Recovery Cellular Repair product

Brand Name:Hong Kong Blue

Model Number:CJC 1295 DAC

Place of Origin:China

.../vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial CAS NO.: 863288-34-0 Synonyms: CJC-1295 DAC, CJC 1295...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap Powdered CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 product

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap Bodybuilding Peptides Mix Ghrp-6 (1mg) plus Ipamorelin (1mg) plus Cjc 1295 (1mg) plus Mgf (500mcg) product

Brand Name:Biofriend

Model Number:87616-84-0

Place of Origin:China

...Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Prohormones Steroids Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Buy cheap CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 product

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:Hunan,China

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Buy cheap Muscle Buidling Injectable 99% Purity Human Growth Peptides CJC-1295 DAC 2mg Per Vial product

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

... Function: Bodybuilding, Burning Fat Storage Temperature: 2-8 Celsius degree Shelf life: 24 Months in proper storage CJC-1295 DAC Information: CJC-1295 DAC and CJC-1295 (known as Modified GRF 1-29)

Hengyang Desen Biotechnology Co., Ltd.
Verified Supplier

Hunan

Buy cheap CAS 51753-57-2 Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Weight Loss product

Brand Name:Gear Steroids

Model Number:51753-57-2

Place of Origin:China

...High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Buy cheap CJC-1295 without DAC Peptides 2mg Injectable Peptides Human Growth Hormone for bodybuilding product

Brand Name:Hongkong SaiChuang

Model Number:863288-34-0

Place of Origin:China

... Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin NO.: 863288-34-0 Molecular Formula: C152H252N44O42 Molecular weight: 3367.2 Molar Mass: 3368.7 Peptide purity: > 98.0% Appearance: White lyophilized powder CJC-1295 without...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Buy cheap Natural Growth Hormone Supplements Cjc-1295 Without Dac For Adult Muscle Enhance product

Brand Name:yuancheng

Model Number:Cjc-1295

Place of Origin:China

.../vial for Muscle Gaining Basic Info: Product Name: Cjc-1295 Without Dac Model NO.: API Customized: Customized Suitable for: Elderly, Adult Purity: >98% Chemical Name: Cjc-1293 Appearance: Powder Storage: Cool&Dry Type...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap CJC-1295 Acetate Cas : 863288-34-0 HGH Human Growth Hormone 2mg or 5mg with Safety Shipping product

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request