Sign In | Join Free | My lightneasy.org
lightneasy.org
Products
Search by Category
Home > Chemicals > Adsorbents >

Cjc 1295 Ghrp 6 Dosage

cjc 1295 ghrp 6 dosage

All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

Total 5180 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
Buy cheap Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 product

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap Polypeptide CJC-1295 2mg/Vial for Fat Burning product

Brand Name:Bodybuilding

Model Number:CJC-1295

Place of Origin:China

...99% Purity White powder Bodybuilding Peptide CJC-1295 2mg/Vial Basic Information for CJC-1295 without DAC Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap Mass-Gains Injectable Protein Peptide Hormones Cjc 1295 No Dac (CJC-1295 without Dac) Powder product

Brand Name:Muscle Man

Model Number:CAS No.: 863288-34-0

Place of Origin:Hunan,China

...Mass-Gains Injectable Protein Peptide Hormones Cjc 1295 No Dac (CJC-1295 without Dac) Powder Basic Information for CJC-1295 without DAC Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CAS NO.: 863288-34...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Buy cheap Increase Growth Hormone Peptide Steroid Hormones CJC-1295 DAC 2mg/vial 5mg/vial Purchase Peptides product

Place of Origin:CHINA

Brand Name:Zhenxiang

Model Number:863288-34-0

...)-NH2 (Drug Affinity Complex) Molecular formula: C165H269N47O46 Molar Mass: 3647.15 CAS number: 863288-34-0 CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH)

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier

Hunan

Buy cheap Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss product

Brand Name:ChineseHormone

Model Number:CAS 863288-34-0

Place of Origin:China

... of time which usually equates to fewer injections. Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss Quick View: Even though CJC 1295’s main function upon creation was found to...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Buy cheap Growth Hormone Peptides CJC 1295 DAC 2mg / vial for Bodybuilding product

Brand Name:kafen

Model Number:N/A

Place of Origin:China

...Growth Hormone Peptides CJC 1295 DAC 2mg / vial for Bodybuilding 1 . Quick Details: Product Name:CJC-1295 DAC Alias: CJC1295(GHRH/DAC) Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap CJC -1295 Without DAC Peptide Hormones Muscle Building CAS 863288-34-0 product

Brand Name:Pharm

Model Number:hannah@chembj.com

Place of Origin:whatsapp: +86 138 7101 4054

...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH). Their...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Hubei

Buy cheap 5mg/vial Protein Peptide Hormones 100% Safe DHL to USA CJC 1295 with Dac product

Brand Name:Bodybiological

Model Number:CJC 1295 with Dac

Place of Origin:Hubei, China

...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Buy cheap White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial product

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap 99% Healthy Anti Aging Hormones Acetate Growth Hormone CAS 863288-34-0 Releasing Hormone GHRH CJC-1295 with DAC product

Brand Name:pharm-china

Model Number:863288-34-0

Place of Origin:China

... Hormone GHRH CJC-1295 with DAC Basic View: CJC-1295 Acetate with DAC growth hormone releasing hormone (GHRH) CJC-1295 Acetate with DAC Specification:2mg/10vials/kit CJC-1295 Acetate with DAC Molecular Formula : C165H269N47O46 CJC-1295 Acetate with...

Shanghai Yijing Pharmaceutical Co.,Ltd
Verified Supplier

Shanghai

Buy cheap Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 product

Brand Name:HKYC

Model Number:muscle building

Place of Origin:HUBEI,CHINA

... know I will give info.in details. kathelin@yccreate.com Skype:live:kathelin_4 WhataApp:+8618872220706 Description 1.CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a releasing hormone (GHRH) analog.One...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap Powerful CJC 1295 With Dac Growth Hormone Peptide 2mg For Lean Muscles product

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap CJC-1295 with DAC Anti Aging CJC-1295 Peptide Hormones Acetate Growth Steroid product

Brand Name:steriodshow

Model Number:863288-34-0

Place of Origin:china manufactuer

...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap Long - half Life Human Peptide 2mg/vial CJC-1295 Dac Injury Recovery Cellular Repair product

Brand Name:Hong Kong Blue

Model Number:CJC 1295 DAC

Place of Origin:China

.../vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial CAS NO.: 863288-34-0 Synonyms: CJC-1295 DAC, CJC 1295...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap Weight Loss Peptide Powder CJC 1295 DAC For Fat Loss CAS 863288-34-0 product

Brand Name:JNJG

Model Number:863288-34-0

Place of Origin:CHINA

...Weight Loss Peptide Powder CJC 1295 DAC For Fat Loss CAS 863288-34-0 Quick Detail Product Name CJC-1295 with DAC Synonym CJC1295/DAC, CJC-1295 with dac, CJC 1295DAC CAS 863288-34-0 MF C165H269N47O46 MW 3647...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap Powdered CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 product

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap Bodybuilding Peptides Mix Ghrp-6 (1mg) plus Ipamorelin (1mg) plus Cjc 1295 (1mg) plus Mgf (500mcg) product

Brand Name:Biofriend

Model Number:87616-84-0

Place of Origin:China

...Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Prohormones Steroids Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Buy cheap 2mg/vial CJC 1295 For Bodybuilder Without DAC , 99% puirty Peptide, white powder product

Brand Name:N/A

Model Number:CJC 1295

Place of Origin:China

...Protuct Name CJC 1295 Appearance white power Molecular Formula C152H252N44O42 Place of Origin China (Mainland) Function bodybuilding, anti-aging ...

Zhongweiye Biological Technology
Site Member

Hebei

Buy cheap CJC-1295 Acetate Cas : 863288-34-0 HGH Human Growth Hormone 2mg or 5mg with Safety Shipping product

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request