Sign In | Join Free | My lightneasy.org
lightneasy.org
Products
Search by Category
Home > Chemicals > Leather Chemicals >

Cjc 1295 Ghrp 6 Dosage

cjc 1295 ghrp 6 dosage

All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

Total 3576 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
China  wholesale

Brand Name:Sendi

Model Number:CJC-1295 With DAC

Place of Origin:China

... Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial CAS: 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 What ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

China  wholesale

Brand Name:Gear Steroids

Model Number:51753-57-2

Place of Origin:China

... High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

China  wholesale

Brand Name:CJC-1295 Without DAC

Model Number:863288-34-0

Place of Origin:China

... CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their ...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

China  wholesale

Brand Name:Shuangbojie

Model Number:Cjc-1295 With Dac

Place of Origin:China

... Content(N%): 80%(by %N) Water Content(Karl Fischer): 6.0% Acetate Content(HPIC): 15.0% Mass Balance: 95.0~105.0% CJC-1295 DAC Description: CJC 1295 with DAC is a powerful ...

Zhuhai Shuangbojie Technology Co.,Ltd
Verified Supplier

Guangdong

China  wholesale

Brand Name:ChineseHormone

Model Number:CAS 863288-34-0

Place of Origin:China

... Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss Quick View: CJC 1295 without DAC is a 30 amino acid peptide hormone, better known in the community ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

China  wholesale

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

... 98% peptides CJC-1295 No Dac 2mg/vial for Bodybuilding Prohormones Growth CJC-1295 without DAC Product Description Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

China  wholesale

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

... Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

China  wholesale

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

... Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

China  wholesale

Brand Name:Hong Kong Blue

Model Number:CJC 1295 DAC

Place of Origin:China

... /vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

China  wholesale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

... Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

China  wholesale

Brand Name:steriodshow

Model Number:CJC-1295(Without DAC) CAS 863288-34-0

Place of Origin:china manufactuer

... CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys- ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

China  wholesale

Brand Name:kafen

Model Number:HGH-Eptifibatide

Place of Origin:Guangzhou,China

... Medicine Grade Drug Human Growth Hormone Peptides CJC 1295 DAC 2 mg / Vial 1 . Introduction other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial Type: ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

China  wholesale

Brand Name:Nanjian

Model Number:Wuhan2017022

Place of Origin:China

... )-NH2 (Drug Affinity Complex) Molecular formula: C165H269N47O46 Molar Mass: 3647.15 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production. ...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

China  wholesale

Brand Name:Huao(skype:mia9403)

Model Number:CJC-1295 with DAC

Place of Origin:China

... Growth Hormone Releasing Hormone GHRH CJC 1295 With DAC For Bodybuilder Contact Abby by trustful@ycgmp.com Skype:mia9403 Whatsapp:+8618826123740 Quick detail : CJC 1295 With ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

China  wholesale

Brand Name:Shanghai Stero

Model Number:CJC 1295 DAC

Place of Origin:China

... Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC Description: CJC-1295 with DAC is a peptide known to help in promoting muscle gain, muscle ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

China  wholesale

Brand Name:Grand Uni or OEM

Model Number:CAS:863288-34-0

Place of Origin:China

... CJC-1295 DAC Bodybuilding Supplements Increase GHRP Production Injection Quick Detail : CJC-1295 Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu- ...

GRAND UNIVERSE INDUSTRIAL LIMITED
Verified Supplier

Guangdong

China  wholesale

Brand Name:Biopro

Model Number:GHP-06

Place of Origin:China

... , if you visit your favorite peptide company’s internet site, you will notice that there is a CJC-1295 with, and another one without DAC. Logically, you will ask yourself – ...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

China  wholesale

Brand Name:CJC-1295 DAC

Model Number:CAS Number 863288-34-0

Place of Origin:China

... GHRH CJC 1295 with DAC 2mg/Vial, Peptides CJC 1295 DAC for Injection with Safe Shipment Detailed Product Description Brand Name CJC 1295 DAC Molecular Formula C165H269N47O46 ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

China  wholesale

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha...

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

China  wholesale

Place of Origin:china

Brand Name:skype: live :hugerawmandy

Model Number:sales16@hugeraw.com

... Ipam Ipamorelin Peptide CJC-1295 DAC Sermorelin USP Peptides For Bodybuilding Quick detail Ipamorelin Alias: Ipamorelin Acetate,Ipamorelin,IPAM, NNC- ...

Hugeraw Health Technology Co.,Ltd
Active Member

Jiangsu

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request