Sign In | Join Free | My lightneasy.org
lightneasy.org
Products
Search by Category

cjc dac dosage

All cjc dac dosage wholesalers & cjc dac dosage manufacturers come from members. We doesn't provide cjc dac dosage products or service, please contact them directly and verify their companies info carefully.

Total 3907 products from cjc dac dosage Manufactures & Suppliers
Buy cheap  product

Brand Name:steroidphar

Model Number:863288-34-0

Place of Origin:China

...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:steriodshow

Model Number:CJC-1295(Without DAC) CAS 863288-34-0

Place of Origin:china manufactuer

...CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:hksteroids.net

Model Number:863288-34-0

Place of Origin:China

.../vial CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

... Muscel Growth Fat Burning Quick detail Product name: CJC1295 without DAC Other name: DJC1295 NO DAC CAS: 863288-34-0 Appearance: white lyophilized powder purity: 99% Trademark: Pharmlab Original: China Grade: Pharmaceutical ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

.../vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer Supply Cjc-1295 Without Dac with Over 98% Purity CJC...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:HKYC

Model Number:PEPTIDE POWDER

Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:Cjc-1295 with Dac

Model Number:863288-34-0

Place of Origin:China

... >>>>>>>>>Cjc-1295 with Dac Quick Details Cjc-1295 with Dac Other name Cjc-1295 Dac Cjc-1295 with Dac CAS 863288-34-0 Cjc-1295 with Dac Molecular Formula C165H271N47O46 Cjc-1295 with Dac Molecular Weight 3649.30 Cjc-1295 with Dac Assay 99% Min. Cjc...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:China, Hunan

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Buy cheap  product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable Polypeptide CJC 1295 with Dac 2mg.vial Growth Hormone Fat Burning 1. CJC-1295 With DAC Description CJC-1295 is basically a peptide hormone that acts similar to growth hormonereleasing hormones (GHRH). Invented by a ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Anabolic-Oral Steroid

Model Number:CJC-1295

Place of Origin:China

...Injectable Peptide Steroid Human Growth CJC-1295 / CJC-1295 without DAC 2mg/vial with Colorful Tops CJC-1295 Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:LSW

Model Number:CAS:863288-34-0

Place of Origin:China

...Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance with reasonable price and safe delivery Product Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Gear Steroids

Model Number:51753-57-2

Place of Origin:China

...High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Buy cheap  product

Brand Name:CJC 1295 DAC

Model Number:N/A

Place of Origin:China

...Human Growth Hormone Peptide Cjc-1295 Without Dac White Lyophilized Powder​ Product Description; Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin Molecular Formula: C165H269N47O46 Molecular weight: 3367.2 Molar Mass: 3368...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Shanghai Stero

Model Number:CJC 1295 DAC

Place of Origin:China

...Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC Description: CJC-1295 with DAC is a peptide known to help in promoting muscle gain, muscle strength, lean body mass and ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Buy cheap  product

Brand Name:ChineseHormone

Model Number:CAS 863288-34-0

Place of Origin:China

...Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss Quick View: CJC 1295 without DAC is a 30 amino acid peptide hormone, better known in the community as a GHRH (growth hormone ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Peptides Steroid Cjc - 1295 Without Dac 2mg / vial for Muscle Enhance Quick Details: CJC-1295 without DAC CAS 863288-34-0 Molecular Formula: C152H252N44O42 Molecular weight: 3367.2 Molar Mass: 3368.7 Peptide purity: > 98...

Zhuhai Shuangbojie Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:CJC 1295

Model Number:CAS 863288-34-0

Place of Origin:China

...Peptide CJC-1295 DAC Peptides For Bodybuilding Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Buy cheap  product

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

Buy cheap  product

Brand Name:CJC-1295 Acetate

Model Number:863288-34-0

Place of Origin:SHANGHAI

... Acetate CAS : 863288 34 0 Human Growth Hormone HGH for Bodybuilding and Weight Loss Product Name: CJC-1295 Acetate Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys...

ShangHai ShuCan industrial co.. LTD
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request