Sign In | Join Free | My lightneasy.org
lightneasy.org
Products
Search by Category
Home > Chemicals > Lab Supplies >

Cjc Dac Dosage

cjc dac dosage

All cjc dac dosage wholesalers & cjc dac dosage manufacturers come from members. We doesn't provide cjc dac dosage products or service, please contact them directly and verify their companies info carefully.

Total 4397 products from cjc dac dosage Manufactures & Suppliers
Buy cheap  product

Brand Name:steriodshow

Model Number:CJC-1295(Without DAC) CAS 863288-34-0

Place of Origin:china manufactuer

...CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:hksteroids.net

Model Number:863288-34-0

Place of Origin:China

.../vial CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:Pharm

Model Number:hannah@chembj.com

Place of Origin:whatsapp: +86 138 7101 4054

...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Hubei

Buy cheap  product

Brand Name:JNJG

Model Number:Cjc1295

Place of Origin:CHINA

...Lab Supply Peptides Cjc-1295 Without DAC 2mg/Vial Powder For Bodybuilding Cjc-1295 Specification: Product Name Cjc1295 Cjc1295 Alias CJC1295 Without DAC Cjc1295 CAS 863288-34-0 Cjc1295 Molecular Formula C165H271N47O46 Cjc1295 Molecular weight...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier

Shandong

Buy cheap  product

Brand Name:Bodybiological

Model Number:CJC 1295 with Dac

Place of Origin:Hubei, China

...-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

...99% Human Growth Peptide CJC-1295 with DAC 2mg CAS 863288-34-0 for Muscle Growth CJC-1295 DAC Quick detail Product Name CJC-1295 With DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Nanjian

Place of Origin:China

...White Lyophilized Peptide Powder 2mg CJC 1295 Without DAC CAS 863288-34-0 Product Name CJC-1295 Synonym CJC-1295 Acetate; CJC1295(Without DAC) CAS NO 863288-34-0 Molecular Formula C165H271N47O46 Molecular weight 3649.30 Purity...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap  product

Brand Name:HKYC

Model Number:PEPTIDE POWDER

Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:China, Hunan

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Buy cheap  product

Brand Name:Cjc-1295 with Dac

Model Number:863288-34-0

Place of Origin:China

... >>>>>>>>>Cjc-1295 with Dac Quick Details Cjc-1295 with Dac Other name Cjc-1295 Dac Cjc-1295 with Dac CAS 863288-34-0 Cjc-1295 with Dac Molecular Formula C165H271N47O46 Cjc-1295 with Dac Molecular Weight 3649.30 Cjc-1295 with Dac Assay 99% Min. Cjc...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:Anabolic-Oral Steroid

Model Number:CJC-1295

Place of Origin:China

...Injectable Peptide Steroid Human Growth CJC-1295 / CJC-1295 without DAC 2mg/vial with Colorful Tops CJC-1295 Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable Polypeptide CJC 1295 with Dac 2mg.vial Growth Hormone Fat Burning 1. CJC-1295 With DAC Description CJC-1295 is basically a peptide hormone that acts similar to growth hormonereleasing hormones (GHRH). Invented by a ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Bodybuilding

Model Number:863288-34-0

Place of Origin:China

...CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap  product

Brand Name:Gear Steroids

Model Number:51753-57-2

Place of Origin:China

...High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Buy cheap  product

Brand Name:steroidphar

Model Number:863288-34-0

Place of Origin:China

...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Active Member

Guangdong

Buy cheap  product

Brand Name:CJC 1295

Model Number:CAS 863288-34-0

Place of Origin:China

...Peptide CJC-1295 DAC Peptides For Bodybuilding Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Buy cheap  product

Brand Name:LSW

Model Number:CAS:863288-34-0

Place of Origin:China

...Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance with reasonable price and safe delivery Product Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34...

Wuhan Lianshangwang Technology Co.,LTD
Active Member

Hong Kong

Buy cheap  product

Brand Name:N/A

Model Number:CJC 1295

Place of Origin:China

...Protuct Name CJC 1295 Appearance white power Molecular Formula C152H252N44O42 Place of Origin China (Mainland) Function bodybuilding, anti-...

Zhongweiye Biological Technology
Site Member

Hebei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request