Sign In | Join Free | My lightneasy.org
lightneasy.org
Products
Search by Category
Home > Chemicals > Pharmaceuticals > Endocrine System Agents >

Sermorelin Acetate Side Effects

sermorelin acetate side effects

All sermorelin acetate side effects wholesalers & sermorelin acetate side effects manufacturers come from members. We doesn't provide sermorelin acetate side effects products or service, please contact them directly and verify their companies info carefully.

Total 2691 products from sermorelin acetate side effects Manufactures & Suppliers
Buy cheap Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate product

Brand Name:YIHAN

Model Number:Sermorelin

Place of Origin:hina

... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Buy cheap Muscle Bodybuilding Sermorelin Acetate 2mg Repair Of Injury product

Brand Name:Bodybiolgical

Model Number:Sermorelin

Place of Origin:Hubei, China

...Repair of Injury Sermorelin Acetate 2mg for Muscle Bodybuilding Detailed information: Sermorelin acetate is a synthetic analog of naturally occurring Growth Hormone-Releasing Hormone (GHRH). GHRH is produced in ...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Buy cheap High Purity Muscle Growth Peptides , Sermorelin Acetate Bodybuilding GRF 1-29 product

Brand Name:Hongxi Pharm

Model Number:SARMs Powder

Place of Origin:HongKong/China

...Sermorelin Acetate Peptide Hormones Bodybuilding Freeze-Dried Powder GRF (1-29) Product Name Sermorelin Acetate Also known as Sermorelin Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than 98.00% Application Type ...

Hongxi International Pharmaceutical Co., Ltd.
Verified Supplier

Hongkong

Buy cheap Sermorelin Acetate Muscle Building Peptides CAS 86168-78-7 With 99% Purity product

Brand Name:TINGYI

Model Number:CAS: 86168-78-7

Place of Origin:CHINA

...What is Sermorelin? Also called as GRF 1-29, Sermorelin is GHRH derivative that contains first, active 29 amino acids chain of GHRH that promote release of growth hormones from the pituitary. Sermorelin forms...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Buy cheap Sermorelin Acetate Peptides Muscle Growth Peptides CAS 86168-78-7 For Building Muscle product

Brand Name:Saichuang

Model Number:86168-78-7

Place of Origin:China

... Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (HPLC): 98.0%min. Sermorelin Appearance...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Buy cheap Sermorelin Acetate GHRP Hormone Injection Peptides For Improving Sleep product

Brand Name:Yihan

Place of Origin:China

Model Number:86168-78-7

...Sermorelin Acetate GHRP Hormone Injection Peptides For Improving Sleep Description Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Buy cheap Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 product

Brand Name:BestSteroid

Model Number:2mg

Place of Origin:Hubei,China

...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap Sermorelin Acetate Local Anesthetic Powder CAS 86168-78-7 White Powder product

Brand Name:Top Pharm

Model Number:86168-78-7

Place of Origin:China

...Peptides Sermorelin Acetate Cas No.86168-78-7 white powder Peptide series hot sell 2mg/vial Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu...

TOP PHARM CO.,LIMITED
Verified Supplier

Buy cheap Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH product

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first...

Hongkong Kangdisen Medical Co., Limited
Site Member

Hong Kong

Buy cheap 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder product

Brand Name:Muscle Man

Model Number:400

Place of Origin:Hunan,China

...2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder Protein Peptide Hormones Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ...

Zhuzhou Interial Biotechnology Co., Ltd
Site Member

Hunan

Buy cheap Sermorelin Acetate CAS : 86168-78-7 Human Growth Hormone HGH for Bodybuilding and Weight Loss product

Brand Name:Sermorelin Acetate

Model Number:86168-78-7

Place of Origin:SHANGHAI

...Sermorelin Acetate CAS : 86168-78-7 Human Growth Hormone HGH for Bodybuilding and Weight Loss​ Product Name: Sermorelin Acetate Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

ShangHai ShuCan industrial co.. LTD
Active Member

Shanghai

Buy cheap Sermorelin Acetate 99.0% bulk powder cas 86168-78-7 product

Categories:API(Active Pharmaceutical Ingredients)

Country/Region:china

... export packing with safe shipment Delivery Detail: imm. shipment Specifications Sermorelin Acetate 99.0%min. safe shipment Product Name Sermorelin Sermorelin Acetate 99.0%min. Product Name Sermorelin Acetate Cas No. 86168-78-7 Purity (HPLC) 99.0%min. safe...

Shenzhen YoungCom Biotech Co., Ltd.
Site Member

Guangdong

Buy cheap Sermorelin Acetate Powder product

Place of Origin:China

... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human...

Wuhan changdashun Technology Co., Ltd
Active Member

Hubei

Buy cheap Sermorelin Acetate product

Brand Name:YC

Place of Origin:wuhan china

...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

Wuhan Yuancheng Gongchuang Technology Co.,Ltd
Active Member

Hubei

Buy cheap Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee product

Brand Name:Youngshe

Model Number:YSPI

Place of Origin:Chengdu , China

...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ...

Chengdu Youngshe Chemical Company
Active Member

Buy cheap Sermorelin Acetate product

Place of Origin:China

Sermorelin Acetate Cas no: 86168-78-7 Sermorelin is used in the treatment of prevention of HIV-induced weight loss, children with growth hormone deficiency or growth failure.

Humans Technology Co.,Ltd
Site Member

Hubei

Buy cheap Bodybuilding supplements peptide Sermorelin acetate 86168-78-7 Factory price fast shipping product

Place of Origin:China

...Bodybuilding supplements Sermorelin acetate 86168-78-7 Factory price fast shipping Base information of Sermorelin acetate Chemical Name: Sermorelin acetate CAS No : 86168-78-7 Sequence :H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-...

Hangzhou Mobel Biotechnology Co.,ltd
Active Member

Zhejiang

Buy cheap GRF 1-29 NH2, Sermorelin Acetate Hydrate / skype:sucy1171 product

Place of Origin:Made in China

Brand Name:YC-WUMEI

Model Number:WUMEI

Contact :Sucy Skype:sucy1171 E -mail:sucy@ycphar.com Whatsapp:+8618872220809 http://www.servechemical.com 1.Quick Details: Usage: Our advantage: Related Products:

Hongkong Yuancheng Gongchuang Technology Co., Limited
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request